PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_004892-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 358aa    MW: 40199.7 Da    PI: 5.7202
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_004892-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEd++l+++++ +G g+W+ ++ + g+ R++k+c++rw +yl
  AHYPO_004892-RA 14 RGLWSPEEDDKLIRYITTHGYGCWSEVPDKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding55.99.6e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T+eE++l++ +++  G++ W+ Ia++++ gRt++++k++w+++
  AHYPO_004892-RA  67 RGRFTPEEEKLIISLHEVVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-24664IPR009057Homeodomain-like
PROSITE profilePS5129416.611961IPR017930Myb domain
SuperFamilySSF466895.62E-3011108IPR009057Homeodomain-like
SMARTSM007176.9E-121363IPR001005SANT/Myb domain
PfamPF002498.7E-151461IPR001005SANT/Myb domain
CDDcd001674.68E-111761No hitNo description
PROSITE profilePS5129426.17962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.9E-2665116IPR009057Homeodomain-like
SMARTSM007172.2E-1766114IPR001005SANT/Myb domain
PfamPF002491.9E-1667111IPR001005SANT/Myb domain
CDDcd001673.57E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDDKLIRYIT THGYGCWSEV PDKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TPEEEKLIIS LHEVVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPS  120
SSSNSPPSSI NTNNSTTSTQ VQAQAQTSNN LFNYPFMIRF GPDPISIVNQ DGPTKESPIS  180
MQESKNNTTP IPSSCPLFMF DTTIPINPIN EDIVGLSSCD QHQQNWNSYN MPMFTTNNMP  240
LFTNCTPTTL NTVSGLDLAN NNYNLPSLID SMENIVPTEV QSCTSERTDH QDHDHDHDDQ  300
MVGVNGWGMI ESQSCPSLLF WDNIEGLALS NINDEVEHQL GQPSSTGSLL SSFPSSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010676421.11e-157PREDICTED: myb-related protein 308
TrEMBLA0A0J8CIZ91e-157A0A0J8CIZ9_BETVU; Uncharacterized protein
STRINGGLYMA08G02080.11e-106(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.11e-85myb domain protein 103